Lineage for d1d1ya_ (1d1y A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1049000Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1049001Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 1049002Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 1049003Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 1049011Species Cow (Bos taurus) [TaxId:9913] [56517] (43 PDB entries)
    Uniprot P29473 67-482
  8. 1049070Domain d1d1ya_: 1d1y A: [59105]
    complexed with 3bt, act, cad, edo, gol, hem, zn

Details for d1d1ya_

PDB Entry: 1d1y (more details), 2.2 Å

PDB Description: bovine endothelial nitric oxide synthase heme domain complexed with 1,3-pbitu (h4b free)
PDB Compounds: (A:) bovine endothelial nitric oxide synthase heme domain

SCOPe Domain Sequences for d1d1ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1ya_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
gpkfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqll
sqardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprc
vgriqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriw
nsqlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfv
lppelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigt
rnlcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaat
vsfmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

SCOPe Domain Coordinates for d1d1ya_:

Click to download the PDB-style file with coordinates for d1d1ya_.
(The format of our PDB-style files is described here.)

Timeline for d1d1ya_: