Lineage for d1d1ya_ (1d1y A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85861Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
  4. 85862Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 85863Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)
  6. 85864Protein Nitric oxide (NO) synthase oxygenase domain [56514] (3 species)
  7. 85865Species Cow (Bos taurus) [TaxId:9913] [56517] (23 PDB entries)
  8. 85904Domain d1d1ya_: 1d1y A: [59105]

Details for d1d1ya_

PDB Entry: 1d1y (more details), 2.2 Å

PDB Description: bovine endothelial nitric oxide synthase heme domain complexed with 1,3-pbitu (h4b free)

SCOP Domain Sequences for d1d1ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1ya_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus)}
gpkfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqll
sqardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprc
vgriqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriw
nsqlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfv
lppelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigt
rnlcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaat
vsfmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

SCOP Domain Coordinates for d1d1ya_:

Click to download the PDB-style file with coordinates for d1d1ya_.
(The format of our PDB-style files is described here.)

Timeline for d1d1ya_: