SCOPe 2.08: Domain d1d1xb_: 1d1x B:

Lineage for d1d1xb_ (1d1x B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56517] (93 PDB entries)
   Uniprot P29473 67-482

8. Domain d1d1xb_: 1d1x B: [59104]
   complexed with 4bt, act, cad, gol, h4b, hem, zn

Details for d1d1xb_

PDB Entry: 1d1x, 2 Å

PDB Description: bovine endothelial nitric oxide synthase heme domain complexed with 1,4-pbitu (h4b bound)

PDB Compounds: (B:) bovine endothelial nitric oxide synthase heme domain

SCOPe Domain Sequences for d1d1xb_:

Sequence; same for both SEQRES and ATOM records:

>d1d1xb_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
kfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqllsq
ardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprcvg
riqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriwns
qlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfvlp
pelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigtrn
lcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaatvs
fmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

Timeline for d1d1xb_:

• d1d1xb_ first appeared in SCOP 1.57
  
• d1d1xb_ appears in SCOPe 2.07