Lineage for d1d1va_ (1d1v A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139732Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
  4. 139733Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 139734Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)
  6. 139735Protein Nitric oxide (NO) synthase oxygenase domain [56514] (3 species)
  7. 139736Species Cow (Bos taurus) [TaxId:9913] [56517] (27 PDB entries)
  8. 139741Domain d1d1va_: 1d1v A: [59101]

Details for d1d1va_

PDB Entry: 1d1v (more details), 1.93 Å

PDB Description: bovine endothelial nitric oxide synthase heme domain complexed with s-ethyl-n-phenyl-isothiourea (h4b bound)

SCOP Domain Sequences for d1d1va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1va_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus)}
gpkfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqll
sqardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprc
vgriqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriw
nsqlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfv
lppelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigt
rnlcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaat
vsfmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

SCOP Domain Coordinates for d1d1va_:

Click to download the PDB-style file with coordinates for d1d1va_.
(The format of our PDB-style files is described here.)

Timeline for d1d1va_: