![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
![]() | Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
![]() | Protein Regulatory subunit of Protein kinase A [51213] (2 species) duplication: consists of two similar domains |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [63861] (2 PDB entries) |
![]() | Domain d1cx4a2: 1cx4 A:266-412 [59100] complexed with cmp; mutant |
PDB Entry: 1cx4 (more details), 2.45 Å
SCOPe Domain Sequences for d1cx4a2:
Sequence, based on SEQRES records: (download)
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Norway rat (Rattus norvegicus) [TaxId: 10116]} esfieslpflkslevserlkvvdvigtkvyndgeqiiaqgdsadsffivesgevritmkr kgksdieengaveiarclrgqyfgelalvtnkpraasahaigtvkclamdvqaferllgp cmeimkrniatyeeqlvalfgtnmdiv
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Norway rat (Rattus norvegicus) [TaxId: 10116]} esfieslpflkslevserlkvvdvigtkvyndgeqiiaqgdsadsffivesgevritmkr ngaveiarclrgqyfgelalvtnkpraasahaigtvkclamdvqaferllgpcmeimkrn iatyeeqlvalfgtnmdiv
Timeline for d1cx4a2: