Lineage for d1cx4a2 (1cx4 A:266-412)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63617Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)
  4. 63715Superfamily b.82.3: cAMP-binding domain-like [51206] (2 families) (S)
  5. 63721Family b.82.3.2: cAMP-binding domain [51210] (2 proteins)
  6. 63737Protein Regulatory subunit of Protein kinase A [51213] (2 species)
  7. 63741Species Rat (Rattus norvegicus) [TaxId:10116] [63861] (1 PDB entry)
  8. 63743Domain d1cx4a2: 1cx4 A:266-412 [59100]

Details for d1cx4a2

PDB Entry: 1cx4 (more details), 2.45 Å

PDB Description: crystal structure of a deletion mutant of the type ii beta regulatory subunit of camp-dependent protein kinase

SCOP Domain Sequences for d1cx4a2:

Sequence, based on SEQRES records: (download)

>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus)}
esfieslpflkslevserlkvvdvigtkvyndgeqiiaqgdsadsffivesgevritmkr
kgksdieengaveiarclrgqyfgelalvtnkpraasahaigtvkclamdvqaferllgp
cmeimkrniatyeeqlvalfgtnmdiv

Sequence, based on observed residues (ATOM records): (download)

>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus)}
esfieslpflkslevserlkvvdvigtkvyndgeqiiaqgdsadsffivesgevritmkr
ngaveiarclrgqyfgelalvtnkpraasahaigtvkclamdvqaferllgpcmeimkrn
iatyeeqlvalfgtnmdiv

SCOP Domain Coordinates for d1cx4a2:

Click to download the PDB-style file with coordinates for d1cx4a2.
(The format of our PDB-style files is described here.)

Timeline for d1cx4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cx4a1