SCOP 1.57: Domain d1cx4a2: 1cx4 A:266-412

Lineage for d1cx4a2 (1cx4 A:266-412)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (2 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (2 proteins)

6. Protein Regulatory subunit of Protein kinase A [51213] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [63861] (1 PDB entry)

8. Domain d1cx4a2: 1cx4 A:266-412 [59100]

Details for d1cx4a2

PDB Entry: 1cx4, 2.45 Å

PDB Description: crystal structure of a deletion mutant of the type ii beta regulatory subunit of camp-dependent protein kinase

SCOP Domain Sequences for d1cx4a2:

Sequence, based on SEQRES records:

>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus)}
esfieslpflkslevserlkvvdvigtkvyndgeqiiaqgdsadsffivesgevritmkr
kgksdieengaveiarclrgqyfgelalvtnkpraasahaigtvkclamdvqaferllgp
cmeimkrniatyeeqlvalfgtnmdiv

Sequence, based on observed residues (ATOM records):

>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus)}
esfieslpflkslevserlkvvdvigtkvyndgeqiiaqgdsadsffivesgevritmkr
ngaveiarclrgqyfgelalvtnkpraasahaigtvkclamdvqaferllgpcmeimkrn
iatyeeqlvalfgtnmdiv

Timeline for d1cx4a2:

• d1cx4a2 is new in SCOP 1.57
  
• d1cx4a2 appears in SCOP 1.59
  
• d1cx4a2 appears in the current release, SCOPe 2.08