Class b: All beta proteins [48724] (119 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) |
Family b.29.1.1: Legume lectins [49900] (4 proteins) |
Protein Legume lectin [49904] (22 species) |
Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (7 PDB entries) |
Domain d1cr7h_: 1cr7 H: [59098] complexed with ca, gal, glc, mn |
PDB Entry: 1cr7 (more details), 2.6 Å
SCOP Domain Sequences for d1cr7h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cr7h_ b.29.1.1 (H:) Legume lectin {Peanut (Arachis hypogaea)} aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
Timeline for d1cr7h_: