Lineage for d1cr7e_ (1cr7 E:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57551Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 57552Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 57553Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 57658Protein Legume lectin [49904] (18 species)
  7. 57777Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (6 PDB entries)
  8. 57802Domain d1cr7e_: 1cr7 E: [59095]

Details for d1cr7e_

PDB Entry: 1cr7 (more details), 2.6 Å

PDB Description: peanut lectin-lactose complex monoclinic form

SCOP Domain Sequences for d1cr7e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cr7e_ b.29.1.1 (E:) Legume lectin {Peanut (Arachis hypogaea)}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOP Domain Coordinates for d1cr7e_:

Click to download the PDB-style file with coordinates for d1cr7e_.
(The format of our PDB-style files is described here.)

Timeline for d1cr7e_: