Lineage for d1c8jb_ (1c8j B:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 155465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
  4. 155466Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 155467Family a.104.1.1: Cytochrome P450 [48265] (8 proteins)
  6. 155504Protein Cytochrome P450-CAM [48266] (1 species)
  7. 155505Species Pseudomonas putida [TaxId:303] [48267] (37 PDB entries)
  8. 155544Domain d1c8jb_: 1c8j B: [59086]

Details for d1c8jb_

PDB Entry: 1c8j (more details), 2.1 Å

PDB Description: crystal structure of cytochrome p450cam mutant (f87w/y96f)

SCOP Domain Sequences for d1c8jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c8jb_ a.104.1.1 (B:) Cytochrome P450-CAM {Pseudomonas putida}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpwipreageafdfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOP Domain Coordinates for d1c8jb_:

Click to download the PDB-style file with coordinates for d1c8jb_.
(The format of our PDB-style files is described here.)

Timeline for d1c8jb_: