| Class b: All beta proteins [48724] (165 folds) |
| Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (3 families) ![]() SH3-like barrel is capped by a C-terminal helix |
| Family b.34.13.1: "Histone-like" proteins from archaea [54161] (1 protein) |
| Protein DNA-binding protein [54162] (2 species) |
| Species Archaeon Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (8 PDB entries) |
| Domain d1c8ca_: 1c8c A: [59084] |
PDB Entry: 1c8c (more details), 1.45 Å
SCOP Domain Sequences for d1c8ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c8ca_ b.34.13.1 (A:) DNA-binding protein {Archaeon Sulfolobus solfataricus, Sso7d [TaxId: 2287]}
matvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmla
kqkk
Timeline for d1c8ca_: