SCOP 1.71: Domain d1c8ca_: 1c8c A:

Lineage for d1c8ca_ (1c8c A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.34: SH3-like barrel [50036] (15 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (3 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.1: "Histone-like" proteins from archaea [54161] (1 protein)

6. Protein DNA-binding protein [54162] (2 species)

7. Species Archaeon Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (7 PDB entries)

8. Domain d1c8ca_: 1c8c A: [59084]

Details for d1c8ca_

PDB Entry: 1c8c, 1.45 Å

PDB Description: crystal structures of the chromosomal proteins sso7d/sac7d bound to dna containing t-g mismatched base pairs

SCOP Domain Sequences for d1c8ca_:

Sequence; same for both SEQRES and ATOM records:

>d1c8ca_ b.34.13.1 (A:) DNA-binding protein {Archaeon Sulfolobus solfataricus, Sso7d}
matvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmla
kqkk

Timeline for d1c8ca_:

• d1c8ca_ first appeared in SCOP 1.57
  
• d1c8ca_ appears in SCOP 1.69
  
• d1c8ca_ appears in SCOP 1.73
  
• d1c8ca_ appears in the current release, SCOPe 2.08