Lineage for d1c8ca_ (1c8c A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130488Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 130647Superfamily d.9.2: Chromo domain-like [54160] (2 families) (S)
  5. 130648Family d.9.2.1: "Histone-like" proteins from archaea [54161] (1 protein)
  6. 130649Protein DNA-binding protein [54162] (2 species)
  7. 130657Species Archaeon Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (6 PDB entries)
  8. 130659Domain d1c8ca_: 1c8c A: [59084]

Details for d1c8ca_

PDB Entry: 1c8c (more details), 1.45 Å

PDB Description: crystal structures of the chromosomal proteins sso7d/sac7d bound to dna containing t-g mismatched base pairs

SCOP Domain Sequences for d1c8ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c8ca_ d.9.2.1 (A:) DNA-binding protein {Archaeon Sulfolobus solfataricus, Sso7d}
matvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmla
kqkk

SCOP Domain Coordinates for d1c8ca_:

Click to download the PDB-style file with coordinates for d1c8ca_.
(The format of our PDB-style files is described here.)

Timeline for d1c8ca_: