Lineage for d1c8bb_ (1c8b B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2125387Superfamily c.56.1: HybD-like [53163] (2 families) (S)
    the HybD fold coincides with the consensus core structure
  5. 2125398Family c.56.1.2: Germination protease [64095] (1 protein)
    elaborated with the N-terminal alpha+beta subdomain and the insertion all-alpha dimerisation subdomain
    automatically mapped to Pfam PF03418
  6. 2125399Protein Germination protease [64096] (1 species)
  7. 2125400Species Bacillus megaterium [TaxId:1404] [64097] (1 PDB entry)
  8. 2125402Domain d1c8bb_: 1c8b B: [59083]

Details for d1c8bb_

PDB Entry: 1c8b (more details), 3 Å

PDB Description: crystal structure of a novel germination protease from spores of bacillus megaterium: structural rearrangements and zymogen activation
PDB Compounds: (B:) spore protease

SCOPe Domain Sequences for d1c8bb_:

Sequence, based on SEQRES records: (download)

>d1c8bb_ c.56.1.2 (B:) Germination protease {Bacillus megaterium [TaxId: 1404]}
mekeldlsqysvrtdlaveakdialenqpkpnnqseikgvivkekeeqgvkismveitee
gaeaigkkkgryvtlesvgireqdtekqeeameevfakelnffikslnipddasclvvgl
gnlsvtpdalgpkavdnllitrhlfelqpesvqdgfrpvsaivpgvmgmtgietsdiifg
vvkkvnpdfiiaidalaarsiervnatiqisdsgihpgsgvgnkrkeisyetlgipviai
giptvvdavsitsdtidfilkhfgremkeqgkpsksllpsgmtfgekkklteddlpneeq
rqtylgmigtlpdeekrrlihevlaplghnlmvtpkevdmfiedmanvvagglnaalhhe
vdqenfgayth

Sequence, based on observed residues (ATOM records): (download)

>d1c8bb_ c.56.1.2 (B:) Germination protease {Bacillus megaterium [TaxId: 1404]}
mekeldlsqysvrtdlaveakdialenqpkvivkekeeqgvkismveiteegaeaigkkk
gryvtlesvgireqdtekqeeameevfakelnffikslnipddasclvvglgnlsvtpda
lgpkavdnllitrhlfelqpesvqdgfrpvsaivpgvmgmtgietsdiifgvvkkvnpdf
iiaidalaarsiervnatiqisdsgihpgsgvgnkrkeisyetlptvvdavsitsdtidf
ilkhfgremkeqglgmigtlpdeekrrlihevlaplghnlmvtpkevdmfiedmanvvag
glnaalhhevdqenfgayth

SCOPe Domain Coordinates for d1c8bb_:

Click to download the PDB-style file with coordinates for d1c8bb_.
(The format of our PDB-style files is described here.)

Timeline for d1c8bb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1c8ba_