Lineage for d1c82a3 (1c82 A:541-814)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58106Fold b.30: Supersandwich [49993] (4 superfamilies)
  4. 58194Superfamily b.30.3: Hyaluronate lyase-like, central domain [50005] (1 family) (S)
  5. 58195Family b.30.3.1: Hyaluronate lyase-like, central domain [50006] (2 proteins)
  6. 58203Protein Hyaluronate lyase [50009] (1 species)
  7. 58204Species Streptococcus pneumoniae [TaxId:1313] [50010] (3 PDB entries)
  8. 58206Domain d1c82a3: 1c82 A:541-814 [59081]
    Other proteins in same PDB: d1c82a1, d1c82a2

Details for d1c82a3

PDB Entry: 1c82 (more details), 1.7 Å

PDB Description: mechanism of hyaluronan binding and degradation: structure of streptococcus pneumoniae hyaluronate lyase in complex with hyaluronic acid disaccharide at 1.7 a resolution

SCOP Domain Sequences for d1c82a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c82a3 b.30.3.1 (A:541-814) Hyaluronate lyase {Streptococcus pneumoniae}
tsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgwytsdgmfylyngd
lshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtsklddanatatmdftnw
nqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpykvyvndkeaslte
qekdypetqsvflessdskknigyfffkkssismskalqkgawkdinegqsdkevenefl
tisqahkqngdsygymlipnvdratfnqmikele

SCOP Domain Coordinates for d1c82a3:

Click to download the PDB-style file with coordinates for d1c82a3.
(The format of our PDB-style files is described here.)

Timeline for d1c82a3: