Lineage for d1c82a2 (1c82 A:815-889)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943485Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 943486Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) (S)
  5. 943487Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)
  6. 943505Protein Hyaluronate lyase [49867] (2 species)
  7. 943506Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [49868] (18 PDB entries)
    Uniprot Q54873 287-1007
  8. 943516Domain d1c82a2: 1c82 A:815-889 [59080]
    Other proteins in same PDB: d1c82a1, d1c82a3
    complexed with cac, na

Details for d1c82a2

PDB Entry: 1c82 (more details), 1.7 Å

PDB Description: mechanism of hyaluronan binding and degradation: structure of streptococcus pneumoniae hyaluronate lyase in complex with hyaluronic acid disaccharide at 1.7 a resolution
PDB Compounds: (A:) hyaluronate lyase

SCOPe Domain Sequences for d1c82a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c82a2 b.24.1.1 (A:815-889) Hyaluronate lyase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
ssliennetlqsvydakqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayyn
petqesapdqevfkk

SCOPe Domain Coordinates for d1c82a2:

Click to download the PDB-style file with coordinates for d1c82a2.
(The format of our PDB-style files is described here.)

Timeline for d1c82a2: