Lineage for d1c82a2 (1c82 A:815-889)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57478Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
  4. 57479Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) (S)
  5. 57480Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (2 proteins)
  6. 57488Protein Hyaluronate lyase [49867] (1 species)
  7. 57489Species Streptococcus pneumoniae [TaxId:1313] [49868] (3 PDB entries)
  8. 57491Domain d1c82a2: 1c82 A:815-889 [59080]
    Other proteins in same PDB: d1c82a1, d1c82a3

Details for d1c82a2

PDB Entry: 1c82 (more details), 1.7 Å

PDB Description: mechanism of hyaluronan binding and degradation: structure of streptococcus pneumoniae hyaluronate lyase in complex with hyaluronic acid disaccharide at 1.7 a resolution

SCOP Domain Sequences for d1c82a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c82a2 b.24.1.1 (A:815-889) Hyaluronate lyase {Streptococcus pneumoniae}
ssliennetlqsvydakqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayyn
petqesapdqevfkk

SCOP Domain Coordinates for d1c82a2:

Click to download the PDB-style file with coordinates for d1c82a2.
(The format of our PDB-style files is described here.)

Timeline for d1c82a2: