Lineage for d1c82a1 (1c82 A:171-540)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100027Fold a.102: alpha/alpha toroid [48207] (4 superfamilies)
  4. 100096Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
  5. 100102Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (2 proteins)
  6. 100110Protein Hyaluronate lyase [48237] (2 species)
  7. 100114Species Streptococcus pneumoniae [TaxId:1313] [48238] (3 PDB entries)
  8. 100116Domain d1c82a1: 1c82 A:171-540 [59079]
    Other proteins in same PDB: d1c82a2, d1c82a3

Details for d1c82a1

PDB Entry: 1c82 (more details), 1.7 Å

PDB Description: mechanism of hyaluronan binding and degradation: structure of streptococcus pneumoniae hyaluronate lyase in complex with hyaluronic acid disaccharide at 1.7 a resolution
PDB Compounds: (A:)

SCOP Domain Sequences for d1c82a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c82a1 a.102.3.2 (A:171-540) Hyaluronate lyase {Streptococcus pneumoniae}
kdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwekfs
nyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksivgn
wwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalggnl
vdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytgaygn
vlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisranse
ghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmqsll
sdagvasvpr

SCOP Domain Coordinates for d1c82a1:

Click to download the PDB-style file with coordinates for d1c82a1.
(The format of our PDB-style files is described here.)

Timeline for d1c82a1: