![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (13 families) ![]() |
![]() | Family d.92.1.1: Zinc protease [55487] (1 protein) |
![]() | Protein Zinc protease [55488] (1 species) |
![]() | Species Streptomyces caespitosus [TaxId:53502] [55489] (2 PDB entries) |
![]() | Domain d1c7ka_: 1c7k A: [59078] |
PDB Entry: 1c7k (more details), 1 Å
SCOP Domain Sequences for d1c7ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c7ka_ d.92.1.1 (A:) Zinc protease {Streptomyces caespitosus} tvtvtydpsnapsfqqeianaaqiwnssvrnvqlraggnadfsyyegndsrgsyaqtdgh grgyifldyqqnqqydstrvtahetghvlglpdhyqgpcselmsgggpgpsctnpypnaq ersrvnalwang
Timeline for d1c7ka_: