Lineage for d1b8ea_ (1b8e A:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily) Superfamily b.60.1: Lipocalins [50814] (3 families) 
Family b.60.1.1: Retinol binding protein-like [50815] (14 proteins) 
Protein beta-Lactoglobulin [50827] (2 species) Species Cow (Bos taurus) [TaxId:9913] [50828] (11 PDB entries) 
Domain d1b8ea_: 1b8e A: [59077]
Details for d1b8ea_
PDB Entry: 1b8e (more details), 1.95 Å
PDB Description: high resolution crystal structure of the bovine beta-lactoglobulin (isoforms a and b) in orthorombic space group
SCOP Domain Sequences for d1b8ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b8ea_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus)}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
clvrtpevddealekfdkalkalpmhirlsfn
SCOP Domain Coordinates for d1b8ea_:
Click to download the PDB-style file with coordinates for d1b8ea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b8ea_:
- d1b8ea_ first appeared in SCOP 1.57
- d1b8ea_ appears in SCOP 1.61
- d1b8ea_ appears in the current release, SCOPe 2.08
View in 3D