Lineage for d1b68a_ (1b68 A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. Superfamily a.24.1: Apolipoprotein [47162] (1 family) (S)
  5. Family a.24.1.1: Apolipoprotein [47163] (2 proteins)
    Can exist in a coiled-coil oligomeric form, see PDB entry 1AV1
    family may also include the five-helical bundle protein Apolipophorin-III
  6. Protein Apolipoprotein E [88703] (3 species)
  7. Species Human (Homo sapiens), E4 [TaxId:9606] [47169] (3 PDB entries)
  8. Domain d1b68a_: 1b68 A: [59076]

Details for d1b68a_

PDB Entry: 1b68 (more details), 2 Å

PDB Description: apolipoprotein e4 (apoe4), 22k fragment
PDB Compounds: (A:) apolipoprotein e

SCOPe Domain Sequences for d1b68a_:

Sequence, based on SEQRES records: (download)

>d1b68a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606]}
gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeql
tpvaeetrarlskelqaaqarlgadmedvrgrlvqyrgevqamlgqsteelrvrlashlr
klrkrllrdaddlqkrlavy

Sequence, based on observed residues (ATOM records): (download)

>d1b68a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606]}
gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeql
taeetrarlskelqaaqarlgadmedvrgrlvqyrgevqamlgqsteelrvrlashlrkl
rkrllrdaddlqkrlavy

SCOPe Domain Coordinates for d1b68a_ are not available.

Timeline for d1b68a_: