Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) |
Family d.185.1.1: MPP-like [63412] (4 proteins) |
Protein Cytochrome bc1 core subunit 2 [63409] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [56001] (3 PDB entries) |
Domain d3bccb1: 3bcc B:18-235 [59058] Other proteins in same PDB: d3bcca1, d3bcca2, d3bccc1, d3bccd2, d3bccd3, d3bcce1, d3bcce2, d3bccf1, d3bccg1, d3bcch1, d3bccj1 |
PDB Entry: 3bcc (more details), 3.7 Å
SCOP Domain Sequences for d3bccb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bccb1 d.185.1.1 (B:18-235) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus)} pphpqdleitklpnglviaslenyspgstigvfikagsryenssnlgtshllrlassltt kgassfkitrgieavggklsvestrenmaytveclrddveilmefllnvttapefrpwev adlqpqlkidkavafqnpqthvienlhaaayrnaladslycpdyrigkvtsvelhdfvqn hftsarmalvglgvshpvlknvaeqllnirgglglsga
Timeline for d3bccb1: