SCOP 1.57: Domain d3bccb1: 3bcc B:18-235

Lineage for d3bccb1 (3bcc B:18-235)

Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
Family d.185.1.1: MPP-like [63412] (4 proteins)
Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
Species Chicken (Gallus gallus) [TaxId:9031] [56001] (3 PDB entries)
Domain d3bccb1: 3bcc B:18-235 [59058]
Other proteins in same PDB: d3bcca1, d3bcca2, d3bccc1, d3bccd2, d3bccd3, d3bcce1, d3bcce2, d3bccf1, d3bccg1, d3bcch1, d3bccj1

Details for d3bccb1

PDB Entry: 3bcc (more details), 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d3bccb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bccb1 d.185.1.1 (B:18-235) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus)}
pphpqdleitklpnglviaslenyspgstigvfikagsryenssnlgtshllrlassltt
kgassfkitrgieavggklsvestrenmaytveclrddveilmefllnvttapefrpwev
adlqpqlkidkavafqnpqthvienlhaaayrnaladslycpdyrigkvtsvelhdfvqn
hftsarmalvglgvshpvlknvaeqllnirgglglsga

SCOP Domain Coordinates for d3bccb1:

Click to download the PDB-style file with coordinates for d3bccb1.
(The format of our PDB-style files is described here.)

Timeline for d3bccb1: