SCOP 1.57: Domain d3bcca2: 3bcc A:233-445

Lineage for d3bcca2 (3bcc A:233-445)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)

5. Family d.185.1.1: MPP-like [63412] (4 proteins)

6. Protein Cytochrome bc1 core subunit 1 [63408] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [55998] (3 PDB entries)

8. Domain d3bcca2: 3bcc A:233-445 [59057]
   Other proteins in same PDB: d3bccb1, d3bccb2, d3bccc1, d3bccd2, d3bccd3, d3bcce1, d3bcce2, d3bccf1, d3bccg1, d3bcch1, d3bccj1

Details for d3bcca2

PDB Entry: 3bcc, 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d3bcca2:

Sequence; same for both SEQRES and ATOM records:

>d3bcca2 d.185.1.1 (A:233-445) Cytochrome bc1 core subunit 1 {Chicken (Gallus gallus)}
kcrftgsqirhredglplahvaiavegpgwahpdlvalqvanaiighydrtyggglhsss
plasiavtnklcqsfqtfsicysetglfgfyfvcdrmsiddmmfvlqgqwmrlctsises
evlrgknflrnalvshldgttpvcedigrelltygrripleeweerlaevdarmvrevcs
kyiydqcpavagpgpieqlpdynrirsgmfwlr

Timeline for d3bcca2:

• d3bcca2 is new in SCOP 1.57
  
• d3bcca2 appears in SCOP 1.59
  
• d3bcca2 appears in the current release, SCOPe 2.08