Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
Family d.185.1.1: MPP-like [63412] (4 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
Protein Cytochrome bc1 core subunit 1 [63408] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [55998] (3 PDB entries) |
Domain d2bcca1: 2bcc A:4-232 [59049] Other proteins in same PDB: d2bccb1, d2bccb2, d2bccc2, d2bccc3, d2bccd2, d2bccd3, d2bcce1, d2bcce2, d2bccf_, d2bccg_, d2bcch_, d2bccj_ |
PDB Entry: 2bcc (more details), 3.5 Å
SCOP Domain Sequences for d2bcca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bcca1 d.185.1.1 (A:4-232) Cytochrome bc1 core subunit 1 {Chicken (Gallus gallus)} yaqalqsvpetqvsqldngvrvaseqssqptctvgvwidagsryeseknngagyflehla fkgtknrpqnalekevesmgahlnayssrehtayyikalskdvpkavelladivqncsle dsqiekerdvivrelqendtsmrevvfnylhatafqgtglaqsvegpsenirklsradlt eylsthytaprmvlaaaggvehqqllelaqkhfggvpftydddavptls
Timeline for d2bcca1: