Lineage for d1slm_1 (1slm 16-80)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 535031Fold a.20: PGBD-like [47089] (1 superfamily)
    core: 3 helices; bundle, closed, left-handed twist; parallel
  4. 535032Superfamily a.20.1: PGBD-like [47090] (2 families) (S)
  5. 535037Family a.20.1.2: MMP N-terminal domain [63427] (4 proteins)
  6. 535054Protein Stromelysin-1 (MMP-3) [63429] (1 species)
  7. 535055Species Human (Homo sapiens), fibroblast [TaxId:9606] [63431] (1 PDB entry)
  8. 535056Domain d1slm_1: 1slm 16-80 [59042]
    Other proteins in same PDB: d1slm_2
    complexed with ca, zn

Details for d1slm_1

PDB Entry: 1slm (more details), 1.9 Å

PDB Description: crystal structure of fibroblast stromelysin-1: the c-truncated human proenzyme

SCOP Domain Sequences for d1slm_1:

Sequence, based on SEQRES records: (download)

>d1slm_1 a.20.1.2 (16-80) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
lvqkylenyydlkkdvkqfvrrkdsgpvvkkiremqkflglevtgkldsdtlevmrkprc
gvpdv

Sequence, based on observed residues (ATOM records): (download)

>d1slm_1 a.20.1.2 (16-80) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
lvqkylenyydlkkdsgpvvkkiremqkflglevtgkldsdtlevmrkprcgvpdv

SCOP Domain Coordinates for d1slm_1:

Click to download the PDB-style file with coordinates for d1slm_1.
(The format of our PDB-style files is described here.)

Timeline for d1slm_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1slm_2