Lineage for d1ruxa1 (1rux A:5-636)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 107845Fold b.13: Nucleoplasmin/PNGase F-like [49741] (3 superfamilies)
  4. 107865Superfamily b.13.2: Viral proteins [49749] (2 families) (S)
  5. 107887Family b.13.2.2: Adenovirus hexon [49753] (1 protein)
  6. 107888Protein Adenovirus hexon [63404] (2 species)
  7. 107892Species Human adenovirus type 5 [TaxId:28285] [49756] (1 PDB entry)
  8. 107893Domain d1ruxa1: 1rux A:5-636 [59040]

Details for d1ruxa1

PDB Entry: 1rux (more details), 2.5 Å

PDB Description: maximum likelihood refinement of adenovirus type 5 hexon with tnt

SCOP Domain Sequences for d1ruxa1:

Sequence, based on SEQRES records: (download)

>d1ruxa1 b.13.2.2 (A:5-636) Adenovirus hexon {Human adenovirus type 5}
mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
pkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginitkegiq
igvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakptneng
gqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthisympt
ikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvdlqdrn
telsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggvintet
ltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialylpdkl
kyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrnaglry
rsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndlrvdg
asikfdsiclyatffpmahntastleamlrnd

Sequence, based on observed residues (ATOM records): (download)

>d1ruxa1 b.13.2.2 (A:5-636) Adenovirus hexon {Human adenovirus type 5}
mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
pkgapnpcewdthvfgqapysginitkegiqigkyadktfqpepqigesqwyeteinhaa
grvlkkttpmkpcygsyakptnenggqgilvesqvemqffsttnltpkvvlysedvdiet
pdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasql
navvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycf
plggvintetltkvkpgwekdafsdkneirvgnnfameinlnanlwrnflysnialylpd
klkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrnagl
ryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndlrv
dgasikfdsiclyatffpmahntastleamlrnd

SCOP Domain Coordinates for d1ruxa1:

Click to download the PDB-style file with coordinates for d1ruxa1.
(The format of our PDB-style files is described here.)

Timeline for d1ruxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ruxa2