SCOPe 2.02: Domain d1qr0a1: 1qr0 A:1-101

Lineage for d1qr0a1 (1qr0 A:1-101)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
   beta-alpha(3)-beta(2) motif

4. Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families)
   possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)

5. Family d.150.1.1: 4'-Phosphopantetheinyl transferase SFP [56215] (1 protein)
   monomeric; tandem duplication of beta-alpha(3)-beta(2) motif

6. Protein 4'-Phosphopantetheinyl transferase SFP [63407] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [56217] (1 PDB entry)

8. Domain d1qr0a1: 1qr0 A:1-101 [59038]
   complexed with coa, mg

Details for d1qr0a1

PDB Entry: 1qr0, 1.9 Å

PDB Description: crystal structure of the 4'-phosphopantetheinyl transferase sfp- coenzyme a complex

PDB Compounds: (A:) 4'-phosphopantetheinyl transferase sfp

SCOPe Domain Sequences for d1qr0a1:

Sequence; same for both SEQRES and ATOM records:

>d1qr0a1 d.150.1.1 (A:1-101) 4'-Phosphopantetheinyl transferase SFP {Bacillus subtilis [TaxId: 1423]}
mkiygiymdrplsqeenerfmtfispekrekcrrfyhkedahrtllgdvlvrsvisrqyq
ldksdirfstqeygkpcipdlpdahfnishsgrwvigafds

Timeline for d1qr0a1:

• d1qr0a1 first appeared in SCOP 1.57
  
• d1qr0a1 appears in SCOPe 2.01
  
• d1qr0a1 appears in SCOPe 2.03
  
• d1qr0a1 appears in the current release, SCOPe 2.08