Lineage for d1qhga2 (1qhg A:319-651)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113231Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 protein domains)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2113240Protein DEXX box DNA helicase [52701] (2 species)
    each AAA domain contains an all-alpha insert subdomain
  7. 2113241Species Bacillus stearothermophilus, PcrA [TaxId:1422] [52702] (5 PDB entries)
  8. 2113246Domain d1qhga2: 1qhg A:319-651 [59033]
    complexed with atp, mg; mutant

Details for d1qhga2

PDB Entry: 1qhg (more details), 2.5 Å

PDB Description: structure of dna helicase mutant with adpnp
PDB Compounds: (A:) ATP-dependent helicase pcra

SCOPe Domain Sequences for d1qhga2:

Sequence, based on SEQRES records: (download)

>d1qhga2 c.37.1.19 (A:319-651) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]}
kpilyyeamneadeaqfvagrireavergerryrdfavlyrtnaqsrvmeemllkanipy
qivgglkfydrkeikdilaylrvianpdddlsllriinvpkrgigastidklvryaadhe
lslfealgelemiglgakaagalaafrsqleqwtqlqeyvsvtelveevldksgyremlk
aertieaqsrlenldeflsvtkhfenvsddksliafltdlalisdldeldgteqaaegda
vmlmtlhaakglefpvvfligmeegifphnrsledddemeeerrlayvgitraeeelvlt
saqmrtlfgniqmdppsrflneipahlletasr

Sequence, based on observed residues (ATOM records): (download)

>d1qhga2 c.37.1.19 (A:319-651) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]}
kpilyyeamneadeaqfvagrireavergerryrdfavlyrtnaqsrvmeemllkanipy
qivgglkfydrkeikdilaylrvianpdddlsllriinvpkrgigastidlfealgelem
iglgakaagalaafrsqleqwtqlqeyvsvtelveevldksgyremlkaertieaqsrle
nldeflsvtkhfenvsddksliafltdlalisgdavmlmtlhaakglefpvvfligmeeg
ifphnrsledddemeeerrlayvgitraeeelvltsaqmrtlfgniqmdppsrflneipa
hlletasr

SCOPe Domain Coordinates for d1qhga2:

Click to download the PDB-style file with coordinates for d1qhga2.
(The format of our PDB-style files is described here.)

Timeline for d1qhga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qhga1