Lineage for d1qcob2 (1qco B:619-917)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85963Fold d.177: FAH [56528] (1 superfamily)
  4. 85964Superfamily d.177.1: FAH [56529] (1 family) (S)
  5. 85965Family d.177.1.1: FAH [56530] (2 proteins)
  6. 85976Protein Fumarylacetoacetate hydrolase, FAH, C-terminal domain [63432] (1 species)
  7. 85977Species Mouse (Mus musculus) [TaxId:10090] [56532] (4 PDB entries)
  8. 85983Domain d1qcob2: 1qco B:619-917 [59024]
    Other proteins in same PDB: d1qcoa1, d1qcob1

Details for d1qcob2

PDB Entry: 1qco (more details), 1.9 Å

PDB Description: crystal structure of fumarylacetoacetate hydrolase complexed with fumarate and acetoacetate

SCOP Domain Sequences for d1qcob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcob2 d.177.1.1 (B:619-917) Fumarylacetoacetate hydrolase, FAH, C-terminal domain {Mouse (Mus musculus)}
atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg
qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard
iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin
lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes
fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpals

SCOP Domain Coordinates for d1qcob2:

Click to download the PDB-style file with coordinates for d1qcob2.
(The format of our PDB-style files is described here.)

Timeline for d1qcob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qcob1