Lineage for d1qcnb1 (1qcn B:501-618)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2047093Superfamily b.34.8: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63433] (2 families) (S)
    automatically mapped to Pfam PF09298
  5. 2047094Family b.34.8.1: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63434] (1 protein)
    contains 5 short helices in the loop between the third and fourth strands
  6. 2047095Protein Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63435] (1 species)
  7. 2047096Species Mouse (Mus musculus) [TaxId:10090] [63436] (5 PDB entries)
  8. 2047106Domain d1qcnb1: 1qcn B:501-618 [59019]
    Other proteins in same PDB: d1qcna2, d1qcnb2, d1qcnb3
    complexed with act, ca, ni

Details for d1qcnb1

PDB Entry: 1qcn (more details), 1.9 Å

PDB Description: crystal structure of fumarylacetoacetate hydrolase
PDB Compounds: (B:) fumarylacetoacetate hydrolase

SCOPe Domain Sequences for d1qcnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcnb1 b.34.8.1 (B:501-618) Fumarylacetoacetate hydrolase, FAH, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
msfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskhqh
vfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlp

SCOPe Domain Coordinates for d1qcnb1:

Click to download the PDB-style file with coordinates for d1qcnb1.
(The format of our PDB-style files is described here.)

Timeline for d1qcnb1: