Lineage for d1phm_1 (1phm 45-198)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.13: PNGase F-like [49741] (2 superfamilies) 
Superfamily b.13.1: PHM/PNGase F [49742] (2 families) 
Family b.13.1.2: Peptidylglycine alpha-hydroxylating monooxygenase, PHM [49746] (1 protein) Protein Peptidylglycine alpha-hydroxylating monooxygenase, PHM [63402] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [49748] (3 PDB entries) 
Domain d1phm_1: 1phm 45-198 [59015]
Details for d1phm_1
PDB Entry: 1phm (more details), 1.9 Å
PDB Description: peptidylglycine alpha-hydroxylating monooxygenase (phm) from rat
SCOP Domain Sequences for d1phm_1:
Sequence, based on SEQRES records: (download)
>d1phm_1 b.13.1.2 (45-198) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Rat (Rattus norvegicus)}
neclgtigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmd
tvhhmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgs
kyfvlqvhygdisafrdnhkdcsgvsvhltrvpq
Sequence, based on observed residues (ATOM records): (download)
>d1phm_1 b.13.1.2 (45-198) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Rat (Rattus norvegicus)}
neclgtigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmd
tvhhmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgs
kyfvlqvhygdinhkdcsgvsvhltrvpq
SCOP Domain Coordinates for d1phm_1:
Click to download the PDB-style file with coordinates for d1phm_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1phm_1:
- d1phm_1 is new in SCOP 1.57
- d1phm_1 appears in SCOP 1.59
- d1phm_1 appears in the current release, SCOPe 2.08, called d1phma1
View in 3D
