Lineage for d1npc__ (1npc -)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 259924Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 259925Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 259931Family d.92.1.2: Thermolysin-like [55490] (4 proteins)
    includes alpha-helical C-terminal domain characteristic for the family
  6. 259938Protein Neutral protease [63415] (1 species)
  7. 259939Species Bacillus cereus, strain dsm 3101 [TaxId:1396] [55496] (2 PDB entries)
  8. 259940Domain d1npc__: 1npc - [59012]
    complexed with ca, zn

Details for d1npc__

PDB Entry: 1npc (more details), 2 Å

PDB Description: the structure of neutral protease from bacillus cereus at 0.2-nm resolution

SCOP Domain Sequences for d1npc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1npc__ d.92.1.2 (-) Neutral protease {Bacillus cereus, strain dsm 3101}
vtgtnkvgtgkgvlgdtkslnttlsgssyylqdntrgatiftydaknrstlpgtlwadad
nvfnaaydaaavdahyyagktydyykatfnrnsindagaplkstvhygsnynnafwngsq
mvygdgdgvtftslsggidvighelthavtenssnliyqnesgalneaisdifgtlvefy
dnrnpdweigediytpgkagdalrsmsdptkygdpdhyskrytgssdnggvhtnsgiink
qayllanggthygvtvtgigkdklgaiyyrantqyftqsttfsqaragavqaaadlygan
saevaavkqsfsavgvn

SCOP Domain Coordinates for d1npc__:

Click to download the PDB-style file with coordinates for d1npc__.
(The format of our PDB-style files is described here.)

Timeline for d1npc__: