Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) |
Family d.92.1.2: Thermolysin-like [55490] (4 proteins) includes alpha-helical C-terminal domain characteristic for the family |
Protein Neutral protease [63415] (1 species) |
Species Bacillus cereus, strain dsm 3101 [TaxId:1396] [55496] (2 PDB entries) |
Domain d1npc__: 1npc - [59012] complexed with ca, zn |
PDB Entry: 1npc (more details), 2 Å
SCOP Domain Sequences for d1npc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1npc__ d.92.1.2 (-) Neutral protease {Bacillus cereus, strain dsm 3101} vtgtnkvgtgkgvlgdtkslnttlsgssyylqdntrgatiftydaknrstlpgtlwadad nvfnaaydaaavdahyyagktydyykatfnrnsindagaplkstvhygsnynnafwngsq mvygdgdgvtftslsggidvighelthavtenssnliyqnesgalneaisdifgtlvefy dnrnpdweigediytpgkagdalrsmsdptkygdpdhyskrytgssdnggvhtnsgiink qayllanggthygvtvtgigkdklgaiyyrantqyftqsttfsqaragavqaaadlygan saevaavkqsfsavgvn
Timeline for d1npc__: