Lineage for d1hx6b2 (1hx6 B:245-384)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 163800Fold b.13: Nucleoplasmin/PNGase F-like [49741] (3 superfamilies)
  4. 163820Superfamily b.13.2: Viral proteins [49749] (2 families) (S)
  5. 163821Family b.13.2.1: Coat protein p3 [49750] (1 protein)
  6. 163822Protein Coat protein p3 [63403] (1 species)
  7. 163823Species Bacteriophage prd1 [TaxId:10658] [49752] (3 PDB entries)
  8. 163827Domain d1hx6b2: 1hx6 B:245-384 [58998]

Details for d1hx6b2

PDB Entry: 1hx6 (more details), 1.65 Å

PDB Description: p3, the major coat protein of the lipid-containing bacteriophage prd1.

SCOP Domain Sequences for d1hx6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hx6b2 b.13.2.1 (B:245-384) Coat protein p3 {Bacteriophage prd1}
ngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdin
ylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnp
ktvnqnarllmgyeyftsrt

SCOP Domain Coordinates for d1hx6b2:

Click to download the PDB-style file with coordinates for d1hx6b2.
(The format of our PDB-style files is described here.)

Timeline for d1hx6b2: