Lineage for d1hx6b2 (1hx6 B:245-384)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821570Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) (S)
    duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
    trimeric; in the trimers, the domains are arranged around pseudo six-fold axis
  5. 2821571Family b.121.2.1: Coat protein p3 [49750] (3 proteins)
  6. Protein Coat protein p3, C-terminal domain [418929] (1 species)
  7. Species Bacteriophage PRD1 [TaxId:10658] [419361] (3 PDB entries)
  8. 2821575Domain d1hx6b2: 1hx6 B:245-384 [58998]
    Other proteins in same PDB: d1hx6a1, d1hx6b1, d1hx6c1
    complexed with cl, mpd, na

Details for d1hx6b2

PDB Entry: 1hx6 (more details), 1.65 Å

PDB Description: p3, the major coat protein of the lipid-containing bacteriophage prd1.
PDB Compounds: (B:) Major capsid protein

SCOPe Domain Sequences for d1hx6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hx6b2 b.121.2.1 (B:245-384) Coat protein p3, C-terminal domain {Bacteriophage PRD1 [TaxId: 10658]}
ngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdin
ylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnp
ktvnqnarllmgyeyftsrt

SCOPe Domain Coordinates for d1hx6b2:

Click to download the PDB-style file with coordinates for d1hx6b2.
(The format of our PDB-style files is described here.)

Timeline for d1hx6b2: