Lineage for d1hx6a2 (1hx6 A:245-384)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 225773Fold b.13: Nucleoplasmin/PNGase F-like [49741] (3 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll
  4. 225793Superfamily b.13.2: Viral proteins [49749] (3 families) (S)
    duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits, form ring structures of six rather than five domains
  5. 225794Family b.13.2.1: Coat protein p3 [49750] (1 protein)
  6. 225795Protein Coat protein p3 [63403] (1 species)
  7. 225796Species Bacteriophage prd1 [TaxId:10658] [49752] (3 PDB entries)
  8. 225798Domain d1hx6a2: 1hx6 A:245-384 [58996]

Details for d1hx6a2

PDB Entry: 1hx6 (more details), 1.65 Å

PDB Description: p3, the major coat protein of the lipid-containing bacteriophage prd1.

SCOP Domain Sequences for d1hx6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hx6a2 b.13.2.1 (A:245-384) Coat protein p3 {Bacteriophage prd1}
ngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdin
ylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnp
ktvnqnarllmgyeyftsrt

SCOP Domain Coordinates for d1hx6a2:

Click to download the PDB-style file with coordinates for d1hx6a2.
(The format of our PDB-style files is described here.)

Timeline for d1hx6a2: