SCOP 1.63: Domain d1hx6a2: 1hx6 A:245-384

Lineage for d1hx6a2 (1hx6 A:245-384)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.13: Nucleoplasmin/PNGase F-like [49741] (3 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll

4. Superfamily b.13.2: Viral proteins [49749] (3 families)
   duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits, form ring structures of six rather than five domains

5. Family b.13.2.1: Coat protein p3 [49750] (1 protein)

6. Protein Coat protein p3 [63403] (1 species)

7. Species Bacteriophage prd1 [TaxId:10658] [49752] (3 PDB entries)

8. Domain d1hx6a2: 1hx6 A:245-384 [58996]

Details for d1hx6a2

PDB Entry: 1hx6, 1.65 Å

PDB Description: p3, the major coat protein of the lipid-containing bacteriophage prd1.

SCOP Domain Sequences for d1hx6a2:

Sequence; same for both SEQRES and ATOM records:

>d1hx6a2 b.13.2.1 (A:245-384) Coat protein p3 {Bacteriophage prd1}
ngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdin
ylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnp
ktvnqnarllmgyeyftsrt

Timeline for d1hx6a2:

• d1hx6a2 first appeared in SCOP 1.57
  
• d1hx6a2 appears in SCOP 1.61
  
• d1hx6a2 appears in SCOP 1.65
  
• d1hx6a2 appears in the current release, SCOPe 2.08