SCOPe 2.05: Domain d1hx6a1: 1hx6 A:15-244

Lineage for d1hx6a1 (1hx6 A:15-244)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families)
   duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
   trimeric; in the trimers, the domains are arranged around pseudo six-fold axis

5. Family b.121.2.1: Coat protein p3 [49750] (1 protein)

6. Protein Coat protein p3 [63403] (1 species)

7. Species Bacteriophage PRD1 [TaxId:10658] [49752] (3 PDB entries)

8. Domain d1hx6a1: 1hx6 A:15-244 [58995]
   complexed with cl, mpd, na

Details for d1hx6a1

PDB Entry: 1hx6, 1.65 Å

PDB Description: p3, the major coat protein of the lipid-containing bacteriophage prd1.

PDB Compounds: (A:) Major capsid protein

SCOPe Domain Sequences for d1hx6a1:

Sequence; same for both SEQRES and ATOM records:

>d1hx6a1 b.121.2.1 (A:15-244) Coat protein p3 {Bacteriophage PRD1 [TaxId: 10658]}
lrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflvkvta
aitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapflssmv
tdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskqrlkl
efannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgq

Timeline for d1hx6a1:

• d1hx6a1 first appeared in SCOP 1.57
  
• d1hx6a1 appears in SCOPe 2.04
  
• d1hx6a1 appears in SCOPe 2.06
  
• d1hx6a1 appears in the current release, SCOPe 2.08