SCOP 1.61: Domain d1hx6a1: 1hx6 A:15-244

Lineage for d1hx6a1 (1hx6 A:15-244)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.13: Nucleoplasmin/PNGase F-like [49741] (3 superfamilies)

4. Superfamily b.13.2: Viral proteins [49749] (2 families)

5. Family b.13.2.1: Coat protein p3 [49750] (1 protein)

6. Protein Coat protein p3 [63403] (1 species)

7. Species Bacteriophage prd1 [TaxId:10658] [49752] (3 PDB entries)

8. Domain d1hx6a1: 1hx6 A:15-244 [58995]

Details for d1hx6a1

PDB Entry: 1hx6, 1.65 Å

PDB Description: p3, the major coat protein of the lipid-containing bacteriophage prd1.

SCOP Domain Sequences for d1hx6a1:

Sequence; same for both SEQRES and ATOM records:

>d1hx6a1 b.13.2.1 (A:15-244) Coat protein p3 {Bacteriophage prd1}
lrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflvkvta
aitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapflssmv
tdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskqrlkl
efannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgq

Timeline for d1hx6a1:

• d1hx6a1 first appeared in SCOP 1.57
  
• d1hx6a1 appears in SCOP 1.59
  
• d1hx6a1 appears in SCOP 1.63
  
• d1hx6a1 appears in the current release, SCOPe 2.08