Lineage for d1hqnc1 (1hqn C:14-244)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 107845Fold b.13: Nucleoplasmin/PNGase F-like [49741] (3 superfamilies)
  4. 107865Superfamily b.13.2: Viral proteins [49749] (2 families) (S)
  5. 107866Family b.13.2.1: Coat protein p3 [49750] (1 protein)
  6. 107867Protein Coat protein p3 [63403] (1 species)
  7. 107868Species Bacteriophage prd1 [TaxId:10658] [49752] (3 PDB entries)
  8. 107885Domain d1hqnc1: 1hqn C:14-244 [58993]

Details for d1hqnc1

PDB Entry: 1hqn (more details), 2.2 Å

PDB Description: the selenomethionine derivative of p3, the major coat protein of the lipid-containing bacteriophage prd1.

SCOP Domain Sequences for d1hqnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqnc1 b.13.2.1 (C:14-244) Coat protein p3 {Bacteriophage prd1}
alrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflvkvt
aaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapflssm
vtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskqrlk
lefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgq

SCOP Domain Coordinates for d1hqnc1:

Click to download the PDB-style file with coordinates for d1hqnc1.
(The format of our PDB-style files is described here.)

Timeline for d1hqnc1: