SCOP 1.59: Domain d1hqnb2: 1hqn B:245-384

Lineage for d1hqnb2 (1hqn B:245-384)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.13: Nucleoplasmin/PNGase F-like [49741] (3 superfamilies)

4. Superfamily b.13.2: Viral proteins [49749] (2 families)

5. Family b.13.2.1: Coat protein p3 [49750] (1 protein)

6. Protein Coat protein p3 [63403] (1 species)

7. Species Bacteriophage prd1 [TaxId:10658] [49752] (3 PDB entries)

8. Domain d1hqnb2: 1hqn B:245-384 [58992]

Details for d1hqnb2

PDB Entry: 1hqn, 2.2 Å

PDB Description: the selenomethionine derivative of p3, the major coat protein of the lipid-containing bacteriophage prd1.

SCOP Domain Sequences for d1hqnb2:

Sequence; same for both SEQRES and ATOM records:

>d1hqnb2 b.13.2.1 (B:245-384) Coat protein p3 {Bacteriophage prd1}
ngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdin
ylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnp
ktvnqnarllmgyeyftsrt

Timeline for d1hqnb2:

• d1hqnb2 first appeared in SCOP 1.57
  
• d1hqnb2 appears in SCOP 1.61
  
• d1hqnb2 appears in the current release, SCOPe 2.08