![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) ![]() duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits trimeric; in the trimers, the domains are arranged around pseudo six-fold axis |
![]() | Family b.121.2.1: Coat protein p3 [49750] (3 proteins) |
![]() | Protein Coat protein p3, N-terminal domain [418928] (1 species) |
![]() | Species Bacteriophage PRD1 [TaxId:10658] [419360] (3 PDB entries) |
![]() | Domain d1hqnb1: 1hqn B:15-244 [58991] Other proteins in same PDB: d1hqna2, d1hqnb2, d1hqnc2 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1hqn (more details), 2.2 Å
SCOPe Domain Sequences for d1hqnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hqnb1 b.121.2.1 (B:15-244) Coat protein p3, N-terminal domain {Bacteriophage PRD1 [TaxId: 10658]} lrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflvkvta aitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapflssmv tdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskqrlkl efannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgq
Timeline for d1hqnb1:
![]() Domains from other chains: (mouse over for more information) d1hqna1, d1hqna2, d1hqnc1, d1hqnc2 |