Lineage for d1hqna2 (1hqn A:245-384)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57065Fold b.13: PNGase F-like [49741] (2 superfamilies)
  4. 57085Superfamily b.13.2: Viral proteins [49749] (2 families) (S)
  5. 57086Family b.13.2.1: Coat protein p3 [49750] (1 protein)
  6. 57087Protein Coat protein p3 [63403] (1 species)
  7. 57088Species Bacteriophage prd1 [TaxId:10658] [49752] (3 PDB entries)
  8. 57102Domain d1hqna2: 1hqn A:245-384 [58990]

Details for d1hqna2

PDB Entry: 1hqn (more details), 2.2 Å

PDB Description: the selenomethionine derivative of p3, the major coat protein of the lipid-containing bacteriophage prd1.

SCOP Domain Sequences for d1hqna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqna2 b.13.2.1 (A:245-384) Coat protein p3 {Bacteriophage prd1}
ngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdin
ylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnp
ktvnqnarllmgyeyftsrt

SCOP Domain Coordinates for d1hqna2:

Click to download the PDB-style file with coordinates for d1hqna2.
(The format of our PDB-style files is described here.)

Timeline for d1hqna2: