Lineage for d1gg4b4 (1gg4 B:599-812)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137975Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families) (S)
    has extra strand located between strands 1 and 2
  5. 2137976Family c.72.2.1: MurCDEF [53624] (5 protein domains)
    automatically mapped to Pfam PF08245
  6. 2137977Protein UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF [53627] (1 species)
  7. 2137978Species Escherichia coli [TaxId:562] [53628] (1 PDB entry)
  8. 2137980Domain d1gg4b4: 1gg4 B:599-812 [58988]
    Other proteins in same PDB: d1gg4a1, d1gg4a3, d1gg4b1, d1gg4b3

Details for d1gg4b4

PDB Entry: 1gg4 (more details), 2.3 Å

PDB Description: crystal structure of escherichia coli udpmurnac-tripeptide d-alanyl-d- alanine-adding enzyme (murf) at 2.3 angstrom resolution
PDB Compounds: (B:) udp-n-acetylmuramoylalanyl-d-glutamyl-2,6-diaminopimelate-d-alanyl-d-alanyl ligase

SCOPe Domain Sequences for d1gg4b4:

Sequence, based on SEQRES records: (download)

>d1gg4b4 c.72.2.1 (B:599-812) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]}
parvvaltgssgktsvkemtaailsqcgntlytagnlnndigvpmtllrltpeydyavie
lganhqgeiawtvsltrpeaalvnnlaaahlegfgslagvakakgeifsglpengiaimn
adnndwlnwqsvigsrkvwrfspnaansdftatnihvtshgteftlqtptgsvdvllplp
grhnianalaaaalsmsvgatldaikaglanlka

Sequence, based on observed residues (ATOM records): (download)

>d1gg4b4 c.72.2.1 (B:599-812) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]}
parvvaltgssgktsvkemtaailsqcgntlytagnlnndigvpmtllrltpeydyavie
lganhqgeiawtvsltrpeaalvnnlaslagvakakgeifsglpengiaimnadnndwln
wqsvigsrkvwrfspnaansdftatnihvtshgteftlqtptgsvdvllplpgrhniana
laaaalsmsvgatldaikaglanlka

SCOPe Domain Coordinates for d1gg4b4:

Click to download the PDB-style file with coordinates for d1gg4b4.
(The format of our PDB-style files is described here.)

Timeline for d1gg4b4: