Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.98: MurF and HprK N-domain-like [63417] (2 superfamilies) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1234; structural similarity of the MurF and HprK extends beyond the core. |
Superfamily c.98.1: MurE/MurF N-terminal domain [63418] (2 families) binds UDP group |
Family c.98.1.1: MurE/MurF N-terminal domain [63419] (2 proteins) |
Protein UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF [63420] (1 species) |
Species Escherichia coli [TaxId:562] [63421] (1 PDB entry) |
Domain d1gg4b3: 1gg4 B:501-598 [58987] Other proteins in same PDB: d1gg4a1, d1gg4a4, d1gg4b1, d1gg4b4 |
PDB Entry: 1gg4 (more details), 2.3 Å
SCOPe Domain Sequences for d1gg4b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gg4b3 c.98.1.1 (B:501-598) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]} misvtlsqltdilngelqgaditldavttdtrkltpgclfvalkgerfdahdfadqakag gagallvsrpldidlpqlivkdtrlafgelaawvrqqv
Timeline for d1gg4b3: