Lineage for d1gg4b3 (1gg4 B:501-598)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 322553Fold c.98: MurF and HprK N-domain-like [63417] (2 superfamilies)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1234; structural similarity of the MurF and HprK extends beyond the core.
  4. 322554Superfamily c.98.1: MurE/MurF N-terminal domain [63418] (1 family) (S)
    binds UDP group
  5. 322555Family c.98.1.1: MurE/MurF N-terminal domain [63419] (2 proteins)
  6. 322556Protein UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF [63420] (1 species)
  7. 322557Species Escherichia coli [TaxId:562] [63421] (1 PDB entry)
  8. 322559Domain d1gg4b3: 1gg4 B:501-598 [58987]
    Other proteins in same PDB: d1gg4a1, d1gg4a4, d1gg4b1, d1gg4b4

Details for d1gg4b3

PDB Entry: 1gg4 (more details), 2.3 Å

PDB Description: crystal structure of escherichia coli udpmurnac-tripeptide d-alanyl-d- alanine-adding enzyme (murf) at 2.3 angstrom resolution

SCOP Domain Sequences for d1gg4b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gg4b3 c.98.1.1 (B:501-598) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli}
misvtlsqltdilngelqgaditldavttdtrkltpgclfvalkgerfdahdfadqakag
gagallvsrpldidlpqlivkdtrlafgelaawvrqqv

SCOP Domain Coordinates for d1gg4b3:

Click to download the PDB-style file with coordinates for d1gg4b3.
(The format of our PDB-style files is described here.)

Timeline for d1gg4b3: