SCOPe 2.07: Domain d1espa_: 1esp A:

Lineage for d1espa_ (1esp A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
   includes alpha-helical C-terminal domain characteristic for the family

6. Protein Neutral protease [63415] (1 species)

7. Species Bacillus cereus, strain dsm 3101 [TaxId:1396] [55496] (2 PDB entries)

8. Domain d1espa_: 1esp A: [58979]
   complexed with ca, zn; mutant

Details for d1espa_

PDB Entry: 1esp, 2.8 Å

PDB Description: neutral protease mutant e144s

PDB Compounds: (A:) neutral protease mutant e144s

SCOPe Domain Sequences for d1espa_:

Sequence; same for both SEQRES and ATOM records:

>d1espa_ d.92.1.2 (A:) Neutral protease {Bacillus cereus, strain dsm 3101 [TaxId: 1396]}
vtgtnkvgtgkgvlgdtkslnttlsgssyylqdntrgatiftydaknrstlpgtlwadad
nvfnaaydaaavdahyyagktydyykatfnrnsindagaplkstvhygsnynnafwngsq
mvygdgdgvtftslsggidvighslthavtenssnliyqnesgalneaisdifgtlvefy
dnrnpdweigediytpgkagdalrsmsdptkygdpdhyskrytgssdnggvhtnsgiink
qayllanggthygvtvtgigkdklgaiyyrantqyftqsttfsqaragavqaaadlygan
saevaavkqsfsavgvn

Timeline for d1espa_:

• d1espa_ first appeared in SCOP 1.57, called d1esp__
  
• d1espa_ appears in SCOPe 2.06
  
• d1espa_ appears in the current release, SCOPe 2.08