SCOP 1.63: Domain d1esp__: 1esp -

Lineage for d1esp__ (1esp -)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families)

5. Family d.92.1.2: Thermolysin-like [55490] (4 proteins)
   includes alpha-helical C-terminal domain characteristic for the family

6. Protein Neutral protease [63415] (1 species)

7. Species Bacillus cereus, strain dsm 3101 [TaxId:1396] [55496] (2 PDB entries)

8. Domain d1esp__: 1esp - [58979]
   complexed with ca, zn; mutant

Details for d1esp__

PDB Entry: 1esp, 2.8 Å

PDB Description: neutral protease mutant e144s

SCOP Domain Sequences for d1esp__:

Sequence; same for both SEQRES and ATOM records:

>d1esp__ d.92.1.2 (-) Neutral protease {Bacillus cereus, strain dsm 3101}
vtgtnkvgtgkgvlgdtkslnttlsgssyylqdntrgatiftydaknrstlpgtlwadad
nvfnaaydaaavdahyyagktydyykatfnrnsindagaplkstvhygsnynnafwngsq
mvygdgdgvtftslsggidvighslthavtenssnliyqnesgalneaisdifgtlvefy
dnrnpdweigediytpgkagdalrsmsdptkygdpdhyskrytgssdnggvhtnsgiink
qayllanggthygvtvtgigkdklgaiyyrantqyftqsttfsqaragavqaaadlygan
saevaavkqsfsavgvn

Timeline for d1esp__:

• d1esp__ first appeared in SCOP 1.57
  
• d1esp__ appears in SCOP 1.61
  
• d1esp__ appears in SCOP 1.65
  
• d1esp__ appears in the current release, SCOPe 2.08, called d1espa_