Lineage for d1esp__ (1esp -)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) 
Family d.92.1.2: Thermolysin-like [55490] (4 proteins) 
Protein Neutral protease [63415] (1 species) Species Bacillus cereus, strain dsm 3101 [TaxId:1396] [55496] (2 PDB entries) 
Domain d1esp__: 1esp - [58979]
Details for d1esp__
PDB Entry: 1esp (more details), 2.8 Å
PDB Description: neutral protease mutant e144s
SCOP Domain Sequences for d1esp__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1esp__ d.92.1.2 (-) Neutral protease {Bacillus cereus, strain dsm 3101}
vtgtnkvgtgkgvlgdtkslnttlsgssyylqdntrgatiftydaknrstlpgtlwadad
nvfnaaydaaavdahyyagktydyykatfnrnsindagaplkstvhygsnynnafwngsq
mvygdgdgvtftslsggidvighslthavtenssnliyqnesgalneaisdifgtlvefy
dnrnpdweigediytpgkagdalrsmsdptkygdpdhyskrytgssdnggvhtnsgiink
qayllanggthygvtvtgigkdklgaiyyrantqyftqsttfsqaragavqaaadlygan
saevaavkqsfsavgvn
SCOP Domain Coordinates for d1esp__:
Click to download the PDB-style file with coordinates for d1esp__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1esp__:
- d1esp__ first appeared in SCOP 1.57
- d1esp__ appears in SCOP 1.61
- d1esp__ appears in the current release, SCOPe 2.08, called d1espa_
View in 3D