Lineage for d1ck7a6 (1ck7 A:31-107)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637353Fold a.20: PGBD-like [47089] (1 superfamily)
    core: 3 helices; bundle, closed, left-handed twist; parallel
  4. 637354Superfamily a.20.1: PGBD-like [47090] (2 families) (S)
  5. 637363Family a.20.1.2: MMP N-terminal domain [63427] (4 proteins)
  6. 637368Protein Gelatinase A (MMP-2) [63428] (1 species)
  7. 637369Species Human (Homo sapiens) [TaxId:9606] [63430] (3 PDB entries)
  8. 637374Domain d1ck7a6: 1ck7 A:31-107 [58969]
    Other proteins in same PDB: d1ck7a1, d1ck7a3, d1ck7a4, d1ck7a5, d1ck7a7
    complexed with ca, cl, na, so4, zn; mutant

Details for d1ck7a6

PDB Entry: 1ck7 (more details), 2.8 Å

PDB Description: gelatinase a (full-length)
PDB Compounds: (A:) protein (gelatinase a)

SCOP Domain Sequences for d1ck7a6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ck7a6 a.20.1.2 (A:31-107) Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 9606]}
pspiikfpgdvapktdkelavqylntfygcpkescnlfvlkdtlkkmqkffglpqtgdld
qntietmrkprcgnpdv

SCOP Domain Coordinates for d1ck7a6:

Click to download the PDB-style file with coordinates for d1ck7a6.
(The format of our PDB-style files is described here.)

Timeline for d1ck7a6: