Lineage for d1cjdb2 (1cjd B:245-384)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2430859Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) (S)
    duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
    trimeric; in the trimers, the domains are arranged around pseudo six-fold axis
  5. 2430860Family b.121.2.1: Coat protein p3 [49750] (2 proteins)
  6. 2430861Protein Coat protein p3 [63403] (1 species)
  7. 2430862Species Bacteriophage PRD1 [TaxId:10658] [49752] (3 PDB entries)
  8. 2430872Domain d1cjdb2: 1cjd B:245-384 [58966]

Details for d1cjdb2

PDB Entry: 1cjd (more details), 1.85 Å

PDB Description: the bacteriophage prd1 coat protein, p3, is structurally similar to human adenovirus hexon
PDB Compounds: (B:) protein (major capsid protein (p3))

SCOPe Domain Sequences for d1cjdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjdb2 b.121.2.1 (B:245-384) Coat protein p3 {Bacteriophage PRD1 [TaxId: 10658]}
ngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdin
ylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnp
ktvnqnarllmgyeyftsrt

SCOPe Domain Coordinates for d1cjdb2:

Click to download the PDB-style file with coordinates for d1cjdb2.
(The format of our PDB-style files is described here.)

Timeline for d1cjdb2: