SCOP 1.57: Domain d1cjdb2: 1cjd B:245-384

Lineage for d1cjdb2 (1cjd B:245-384)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.13: PNGase F-like [49741] (2 superfamilies)

4. Superfamily b.13.2: Viral proteins [49749] (2 families)

5. Family b.13.2.1: Coat protein p3 [49750] (1 protein)

6. Protein Coat protein p3 [63403] (1 species)

7. Species Bacteriophage prd1 [TaxId:10658] [49752] (3 PDB entries)

8. Domain d1cjdb2: 1cjd B:245-384 [58966]

Details for d1cjdb2

PDB Entry: 1cjd, 1.85 Å

PDB Description: the bacteriophage prd1 coat protein, p3, is structurally similar to human adenovirus hexon

SCOP Domain Sequences for d1cjdb2:

Sequence; same for both SEQRES and ATOM records:

>d1cjdb2 b.13.2.1 (B:245-384) Coat protein p3 {Bacteriophage prd1}
ngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdin
ylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnp
ktvnqnarllmgyeyftsrt

Timeline for d1cjdb2:

• d1cjdb2 is new in SCOP 1.57
  
• d1cjdb2 appears in SCOP 1.59
  
• d1cjdb2 appears in the current release, SCOPe 2.08