Lineage for d1cjdb1 (1cjd B:13-244)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 163800Fold b.13: Nucleoplasmin/PNGase F-like [49741] (3 superfamilies)
  4. 163820Superfamily b.13.2: Viral proteins [49749] (2 families) (S)
  5. 163821Family b.13.2.1: Coat protein p3 [49750] (1 protein)
  6. 163822Protein Coat protein p3 [63403] (1 species)
  7. 163823Species Bacteriophage prd1 [TaxId:10658] [49752] (3 PDB entries)
  8. 163832Domain d1cjdb1: 1cjd B:13-244 [58965]

Details for d1cjdb1

PDB Entry: 1cjd (more details), 1.85 Å

PDB Description: the bacteriophage prd1 coat protein, p3, is structurally similar to human adenovirus hexon

SCOP Domain Sequences for d1cjdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjdb1 b.13.2.1 (B:13-244) Coat protein p3 {Bacteriophage prd1}
aalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflvkv
taaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapflss
mvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskqrl
klefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgq

SCOP Domain Coordinates for d1cjdb1:

Click to download the PDB-style file with coordinates for d1cjdb1.
(The format of our PDB-style files is described here.)

Timeline for d1cjdb1: